Structure of PDB 1iyi Chain D
Receptor sequence
| >1iyiD (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] |
| PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI PILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSC FPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADF YWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
3D structure
| PDB | 1iyi Mechanism of metal activation of human hematopoietic prostaglandin D synthase | ||
| Chain | D | ||
| Resolution | 1.8 Å | ||
| 3D structure |
|
Enzymatic activity
| Catalytic site (original residue number in PDB) | Y608 R614 R619 W704 |
| Catalytic site (residue number reindexed from 1) | Y7 R13 R18 W103 |
| Enzyme Commision number | 2.5.1.18: glutathione transferase. 5.3.99.2: prostaglandin-D synthase. |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | GSH | D | Y608 R614 W639 K643 K650 I651 Q663 S664 | Y7 R13 W38 K42 K49 I50 Q62 S63 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0000287 | magnesium ion binding |
| GO:0004364 | glutathione transferase activity |
| GO:0004667 | prostaglandin-D synthase activity |
| GO:0005509 | calcium ion binding |
| GO:0005515 | protein binding |
| GO:0016740 | transferase activity |
| GO:0016853 | isomerase activity |
| GO:0042803 | protein homodimerization activity |
| GO:0046872 | metal ion binding |
