Structure of PDB 1iqc Chain D

Receptor sequence

>1iqcD (length=308) Species: 915 (Nitrosomonas europaea)

ANEPIQPIKAVTPENADMAELGKMLFFDPRLSKSGFISCNSCHNLSMGGT
DNITTSIGHKWQQGPINAPTVLNSSMNLAQFWDGRAKDLKEQAAGPIANP
KEMASTHEIAEKVVASMPQYRERFKKVFGSDEVTIDRITTAIAQFEETLV
TPGSKFDKWLEGDKNALNQDELEGYNLFKGSGCVQCHNGPAVGGSSYQKM
GVFKPYETKNPAAGRMDVTGNEADRNVFKVPTLRNIELTYPYFHDGGAAT
LEQAVETMGRIQLNREFNKDEVSKIVAFLKTLTGDQPDFKLPILPPSNND
TPRSQPYE

3D structure

• PDB: 1iqc Crystal structure of Nitrosomonas europaea cytochrome c peroxidase and the structural basis for ligand switching in bacterial di-heme peroxidases
• Chain: D
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E102
• Catalytic site (residue number reindexed from 1): E102
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	D	N67 T239 P241	N67 T239 P241
BS02	HEC	D	F26 C39 C42 H43 S56 I66 A68 P69 N77 Q80 F81 W82 R85 Q92 P96 E102 E146 K229	F26 C39 C42 H43 S56 I66 A68 P69 N77 Q80 F81 W82 R85 Q92 P96 E102 E146 K229
BS03	HEC	D	W82 F178 C183 C186 H187 Q198 F228 P231 L233 I236 F243 H244 M258 Q262 L263 F267	W82 F178 C183 C186 H187 Q198 F228 P231 L233 I236 F243 H244 M258 Q262 L263 F267

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0004601 peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1iqc, PDBe:1iqc, PDBj:1iqc
• PDBsum: 1iqc
• PubMed: 11695895
• UniProt: P55929|CCPR_NITEU Cytochrome c551 peroxidase (Gene Name=ccp)