Structure of PDB 1id3 Chain D

Receptor sequence
>1id3D (length=93) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAA
YNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSST
3D structure
PDB1id3 Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
ChainD
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R36 Q59 K89 S90 T91 R1 Q24 K54 S55 T56
BS02 MN D E108 H112 E73 H77
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1id3, PDBe:1id3, PDBj:1id3
PDBsum1id3
PubMed11566884
UniProtP02294|H2B2_YEAST Histone H2B.2 (Gene Name=HTB2)

[Back to BioLiP]