Structure of PDB 1hnz Chain D

Receptor sequence

>1hnzD (length=208) Species: 274 (Thermus thermophilus)

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

• PDB: 1hnz The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
• Chain: D
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	G2 I5 P7 V8 C9 R10 R13 K22 E24 R25 K30 R35 R36 Y38 P40 G41 Q42 H43 Q45 K46 S52 Y54 A55 R59 Q62 R65 R66 E72 R73 Q74 S113 R115 Q116 R118 Q119 R122 H123 H125 R132 V133 D134 L135 S137 Y138 L155 S208 R209	G1 I4 P6 V7 C8 R9 R12 K21 E23 R24 K29 R34 R35 Y37 P39 G40 Q41 H42 Q44 K45 S51 Y53 A54 R58 Q61 R64 R65 E71 R72 Q73 S112 R114 Q115 R117 Q118 R121 H122 H124 R131 V132 D133 L134 S136 Y137 L154 S207 R208
BS02	MG	D	S83 G87 T89	S82 G86 T88

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1hnz, PDBe:1hnz, PDBj:1hnz
• PDBsum: 1hnz
• PubMed: 11163189
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)