Structure of PDB 1hbr Chain D

Receptor sequence

>1hbrD (length=146) Species: 9031 (Gallus gallus)

VHWTAEEKQLITGLWGKVNVAECGAEALARLLIVYPWTQRFFASFGNLSS
PTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDP
ENFRLLGDILIIVLAAHFSKDFTPECQAAWQKLVRVVAHALARKYH

3D structure

• PDB: 1hbr The structural and functional analysis of the hemoglobin D component from chicken.
• Chain: D
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	T38 F42 H63 K66 L88 H92 L96 V98 N102 F103 L106 L141	T38 F42 H63 K66 L88 H92 L96 V98 N102 F103 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0030492 hemoglobin binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005615 extracellular space
• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:1hbr, PDBe:1hbr, PDBj:1hbr
• PDBsum: 1hbr
• PubMed: 10037733
• UniProt: P02112|HBB_CHICK Hemoglobin subunit beta (Gene Name=HBB)