Structure of PDB 1h48 Chain D

Receptor sequence

>1h48D (length=158) Species: 511693 (Escherichia coli BL21)

LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDAL
LGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTI
IAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIAC
EAVALLIK

3D structure

• PDB: 1h48 The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
• Chain: D
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CDI	D	D8 H10 H34 S35 H42 I57 G58 F61 D63	D10 H12 H36 S37 H44 I59 G60 F63 D65
BS02	ZN	D	D8 H10 H42	D10 H12 H44
BS03	MN	D	H5 E149	H7 E151
BS04	C5P	D	A100 K104 M105 L106 A131 T132 T133	A102 K106 M107 L108 A133 T134 T135
BS05	GPP	D	F7 G138 F139 R142	F9 G140 F141 R144

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008685 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity
• GO:0016829 lyase activity
• GO:0030145 manganese ion binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006744 ubiquinone biosynthetic process
• GO:0008299 isoprenoid biosynthetic process
• GO:0016114 terpenoid biosynthetic process
• GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway

External links

• PDB: RCSB:1h48, PDBe:1h48, PDBj:1h48
• PDBsum: 1h48
• PubMed: 15608374
• UniProt: P62617|ISPF_ECOLI 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Gene Name=ispF)