Structure of PDB 1gyb Chain D

Receptor sequence

>1gybD (length=120) Species: 4932 (Saccharomyces cerevisiae)

FNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKL
VSLPFQKVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFH
LIPDGNSYYVFNDIFRLNYS

3D structure

• PDB: 1gyb Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats
• Chain: D
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	M36 Q43	M32 Q39
BS02	peptide	D	Q72 P73 P76	Q68 P69 P72

Gene Ontology

Molecular Function

• GO:0031267 small GTPase binding
• GO:0061608 nuclear import signal receptor activity

Biological Process

• GO:0006606 protein import into nucleus
• GO:0006913 nucleocytoplasmic transport
• GO:0015031 protein transport

Cellular Component

• GO:0005635 nuclear envelope
• GO:0005737 cytoplasm
• GO:0044613 nuclear pore central transport channel

External links

• PDB: RCSB:1gyb, PDBe:1gyb, PDBj:1gyb
• PDBsum: 1gyb
• PubMed: 12065398
• UniProt: P33331|NTF2_YEAST Nuclear transport factor 2 (Gene Name=NTF2)