Structure of PDB 1fsx Chain D

Receptor sequence
>1fsxD (length=145) Species: 9913 (Bos taurus) [Search protein sequence]
MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTA
DAVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPE
NFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH
3D structure
PDB1fsx The X-ray structure determination of bovine carbonmonoxy hemoglobin at 2.1 A resoultion and its relationship to the quaternary structures of other hemoglobin crystal froms.
ChainD
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D F641 F642 H663 K666 V667 L688 H692 L696 V698 N702 F703 L706 L741 F40 F41 H62 K65 V66 L87 H91 L95 V97 N101 F102 L105 L140
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0031721 hemoglobin alpha binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1fsx, PDBe:1fsx, PDBj:1fsx
PDBsum1fsx
PubMed11369847
UniProtP02070|HBB_BOVIN Hemoglobin subunit beta (Gene Name=HBB)

[Back to BioLiP]