Structure of PDB 1fhj Chain D

Receptor sequence

>1fhjD (length=146) Species: 68728 (Chrysocyon brachyurus)

VHLTAEEKSLVSGLWGKVNVDEVGGEALGRLLIVYPWTQRFFDSFGDLST
PDAVMSNAKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDP
ENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH

3D structure

• PDB: 1fhj Crystal structure of hemoglobin from the maned wolf (Chrysocyon brachyurus) using synchrotron radiation.
• Chain: D
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	T38 F41 H63 H92 L96 V98 N102 F103 L106 L141	T38 F41 H63 H92 L96 V98 N102 F103 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1fhj, PDBe:1fhj, PDBj:1fhj
• PDBsum: 1fhj
• PubMed: 14683506
• UniProt: P60526|HBB_CHRBR Hemoglobin subunit beta (Gene Name=HBB)