Structure of PDB 1eqz Chain D

Receptor sequence
>1eqzD (length=89) Species: 9031 (Gallus gallus) [Search protein sequence]
GAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLE
NVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB1eqz Asymmetries in the nucleosome core particle at 2.5 A resolution.
ChainD
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R36 R45 R23 R32
BS02 dna D V21 R23 R35 R45 I46 S47 G48 R78 K79 T80 V8 R10 R22 R32 I33 S34 G35 R65 K66 T67
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eqz, PDBe:1eqz, PDBj:1eqz
PDBsum1eqz
PubMed11092917
UniProtP62801|H4_CHICK Histone H4 (Gene Name=H4-I)

[Back to BioLiP]