Structure of PDB 1dce Chain D

Receptor sequence

>1dceD (length=329) Species: 10116 (Rattus norvegicus)

TQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYW
GLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAV
QILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVAT
LALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLA
ITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKII
GRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLG
EEQIKPVSPVFCMPEEVLQRVNVQPELVS

3D structure

• PDB: 1dce Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
• Chain: D
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H190 R232 K235 D238 C240 Y241 D280 D287 H290
• Catalytic site (residue number reindexed from 1): H188 R230 K233 D236 C238 Y239 D278 D285 H288
• Enzyme Commision number: 2.5.1.60: protein geranylgeranyltransferase type II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	D238 C240 H290	D236 C238 H288

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004659 prenyltransferase activity
• GO:0004661 protein geranylgeranyltransferase activity
• GO:0004663 Rab geranylgeranyltransferase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008318 protein prenyltransferase activity
• GO:0019840 isoprenoid binding
• GO:0031267 small GTPase binding
• GO:0046872 metal ion binding

Biological Process

• GO:0018344 protein geranylgeranylation

Cellular Component

• GO:0005968 Rab-protein geranylgeranyltransferase complex

External links

• PDB: RCSB:1dce, PDBe:1dce, PDBj:1dce
• PDBsum: 1dce
• PubMed: 10745007
• UniProt: Q08603|PGTB2_RAT Geranylgeranyl transferase type-2 subunit beta (Gene Name=Rabggtb)