Structure of PDB 1c0w Chain D

Receptor sequence
>1c0wD (length=175) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence]
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERD
GLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEA
CRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVVQINEIFQVET
DQFTQLLDADIRVVELLDDLAHTIR
3D structure
PDB1c0w Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
ChainD
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R27 A28 S42 R26 A27 S41
BS02 dna D T7 Q36 S37 P39 T40 Q43 R47 R50 T6 Q35 S36 P38 T39 Q42 R46 R49
BS03 CO D H79 E83 H98 E170 Q173 H78 E82 H97 E144 Q147
BS04 CO D M10 C102 E105 H106 M9 C101 E104 H105
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0017124 SH3 domain binding
GO:0042802 identical protein binding
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1c0w, PDBe:1c0w, PDBj:1c0w
PDBsum1c0w
PubMed10497029
UniProtP0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)

[Back to BioLiP]