Structure of PDB 1by4 Chain D

Receptor sequence
>1by4D (length=80) Species: 9606 (Homo sapiens) [Search protein sequence]
SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCL
IDKRQRNRCQYCRYQKCLAMGMKREAVQEE
3D structure
PDB1by4 Structural basis of RXR-DNA interactions.
ChainD
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K2245 H2246 Y2247 R2264 V2305 Q2306 K17 H18 Y19 R36 V77 Q78 PDBbind-CN: Kd=350nM
BS02 dna D E2253 G2254 F2258 R2261 R2284 N2285 Q2288 R2291 E25 G26 F30 R33 R56 N57 Q60 R63 PDBbind-CN: Kd=350nM
BS03 ZN D C2235 C2238 C2252 C2255 C7 C10 C24 C27
BS04 ZN D C2271 C2277 C2287 C2290 C43 C49 C59 C62
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1by4, PDBe:1by4, PDBj:1by4
PDBsum1by4
PubMed10669605
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]