Structure of PDB 1afc Chain D

Receptor sequence
>1afcD (length=127) Species: 9913 (Bos taurus) [Search protein sequence]
KPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLAAESIGEVYIKST
ETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFV
GLKKNGRSKLGPRTHFGQKAILFLPLP
3D structure
PDB1afc Structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor.
ChainD
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GU4 D K112 K113 K118 K103 K104 K109
BS02 YYJ D K112 R116 K118 R122 K103 R107 K109 R113
Gene Ontology
Molecular Function
GO:0005104 fibroblast growth factor receptor binding
GO:0005178 integrin binding
GO:0005515 protein binding
GO:0008083 growth factor activity
GO:0008201 heparin binding
GO:0044548 S100 protein binding
Biological Process
GO:0001525 angiogenesis
GO:0008284 positive regulation of cell population proliferation
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0009887 animal organ morphogenesis
GO:0010595 positive regulation of endothelial cell migration
GO:0010628 positive regulation of gene expression
GO:0030154 cell differentiation
GO:0030334 regulation of cell migration
GO:0030335 positive regulation of cell migration
GO:0032148 activation of protein kinase B activity
GO:0034605 cellular response to heat
GO:0045542 positive regulation of cholesterol biosynthetic process
GO:0045766 positive regulation of angiogenesis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051781 positive regulation of cell division
GO:0060681 branch elongation involved in ureteric bud branching
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0072163 mesonephric epithelium development
GO:1901509 regulation of endothelial tube morphogenesis
GO:1902533 positive regulation of intracellular signal transduction
GO:1903672 positive regulation of sprouting angiogenesis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005938 cell cortex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1afc, PDBe:1afc, PDBj:1afc
PDBsum1afc
PubMed7520817
UniProtP03968|FGF1_BOVIN Fibroblast growth factor 1 (Gene Name=FGF1)

[Back to BioLiP]