Structure of PDB 8pv6 Chain Cz

Receptor sequence

>8pv6Cz (length=103) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

KNLGMRKNGQVWLPAKKAFRPTKGLTSWELRVKKRQEQAAMKAKEREMKE
EKEAERQKRIQAIKERRKKKEEKERYEQLAAKMHKKRLERLKRKEKRNKL
LNS

3D structure

PDB

8pv6 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.94 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cz	G24 M25 R26 K27 N28 Q30 W32 L33 K36 K37 A38 F39 R40 K43 W48 R51 R55 K62 R76 I80 R87 H104 L108 E109 R110 R113 K114 E115 K116 K119 L120	G4 M5 R6 K7 N8 Q10 W12 L13 K16 K17 A18 F19 R20 K23 W28 R31 R35 K42 R56 I60 R67 H84 L88 E89 R90 R93 K94 E95 K96 K99 L100
BS02	rna	Cz	I83 R86 R87	I63 R66 R67

Gene Ontology

	Biological Process
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus

External links