Structure of PDB 7cgo Chain Cs |
>7cgoCs (length=150) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
DAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEH YSPNGDASKATLRSRQLNISEQVPRSTQRNETSNYEVDRTIRHTKMNVGD IERLSVAVVVNYKLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFS |
|
PDB | 7cgo Structural basis of assembly and torque transmission of the bacterial flagellar motor. |
Chain | Cs |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
Cs |
T278 I372 H374 |
T47 I91 H93 |
|
|
|
|