Structure of PDB 4v7e Chain Cr

Receptor sequence

>4v7eCr (length=73) Species: 4565 (Triticum aestivum)

VTIQPSGVKDAAVVLSTTKTKKQNAPAKLYHKSVMRKEFRKMAKAVKNQV
SDNYYRPDLTKPALARLSSVYRS

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: Cr
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cr	V58 T59 I60 P62 Q80 H88 V91 M92 F96 V107 S108 D109 R113	V1 T2 I3 P5 Q23 H31 V34 M35 F39 V50 S51 D52 R56

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Mar 10 15:45:08 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7e', asym_id = 'Cr', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7e', asym_id='Cr', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v7e', asym_id = 'Cr'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v7e', asym_id='Cr')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>