Structure of PDB 8jiv Chain Co

Receptor sequence

>8jivCo (length=98) Species: 4565 (Triticum aestivum) [Search protein sequence]

VNVPKTKKTYCKNKECKKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYG
GQTKPVFHKKAKTTKKIVLKLQCQSCKHYSQRAIKRCKHFEIGGDKKG

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Co	V2 N3 P5 K8 T10 Y11 K13 K19 H20 Y28 K30 G31 D33 S34 S36 A37 Q38 G39 R41 R42 R45 K46 G49 Y50 G51 G52 Q53 X55 P56 V57 F58 K60 K61 A62 K63 T65 K66 K67 V69 H79 Y80 Q82 R83 K86 R87 C88 K89 K97 K98	V1 N2 P4 K7 T9 Y10 K12 K18 H19 Y27 K29 G30 D32 S33 S35 A36 Q37 G38 R40 R41 R44 K45 G48 Y49 G50 G51 Q52 X54 P55 V56 F57 K59 K60 A61 K62 T64 K65 K66 V68 H78 Y79 Q81 R82 K85 R86 C87 K88 K96 K97
BS02	ZN	Co	C12 C74	C11 C73

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links