Structure of PDB 6hiw Chain Cn

Receptor sequence

>6hiwCn (length=110) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

RWAAKFYGQVTFGPRNYPYPSSRWLARRFQMKKHRIIKRFRFRRYKLAAV
ANLPFAKMIRVGMLPELKSSKTKRGDVVDPTLSGQLVSAVKNTGEKRKGQ
RTRPKSKYQV

3D structure

PDB

6hiw Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

Chain

Resolution

3.37 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cn	R141 K145 F146 T151 F152 P154 R155 N156 Y157 P158 Y159 P160 S161 S162 R163 W164 A166 R167 R168 Q170 M171 K172 K173 H174 R175 K178 R181 R183 Y185 K186 R200 G202 M203 S210 K213 K238 G239 Q240 R241 T242 R243 S246 K247	R1 K5 F6 T11 F12 P14 R15 N16 Y17 P18 Y19 P20 S21 S22 R23 W24 A26 R27 R28 Q30 M31 K32 K33 H34 R35 K38 R41 R43 Y45 K46 R60 G62 M63 S70 K73 K98 G99 Q100 R101 T102 R103 S106 K107

Gene Ontology

	Cellular Component
GO:0005739	mitochondrion
GO:0020023	kinetoplast

External links