Structure of PDB 8jiv Chain Cm

Receptor sequence
>8jivCm (length=50) Species: 4565 (Triticum aestivum) [Search protein sequence]
IEPSLQALARKYNQEKMICRKCYARLHPRAVNCRKKKCGHSNQLRPKKKI
3D structure
PDB8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
ChainCm
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Cm K17 R21 Y24 R26 H28 R30 N33 R35 K36 K37 K38 G40 H41 N43 R46 K48 K49 K16 R20 Y23 R25 H27 R29 N32 R34 K35 K36 K37 G39 H40 N42 R45 K47 K48
BS02 ZN Cm C20 C23 C34 C39 C19 C22 C33 C38
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum8jiv
PubMed38458197
UniProtA0A1D5XNC2

[Back to BioLiP]