Structure of PDB 8rd8 Chain Cl

Receptor sequence

>8rd8Cl (length=272) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

PIVKAKPTSPGRRFVEKVVHPHLYKGRPFAALLESKSKTGGRNNNGRITT
RHIGGGHKQHYRIIDFKRTKDNIPATVERIEYDPNRTAHIALLKYADGER
RYIIAAKKQAVGDTVMSGEASPIRPGNCLPLKNIPLGTVIHNIELKIGKG
AQMARAAGASVQLLGRDGIYAILRLRSGETRRVHVNCRAVIGEVSNTENN
LKSLGKAGASRWRGIRPSVRGVAMNPVDHPHGGGEGRNKGRHPTSPWGQK
SKGLKTRHNKRTDSMIIRRAKK

3D structure

PDB

8rd8 A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cl	K7 P8 T9 S10 P11 G12 R13 R14 F15 K18 R28 E35 S38 K39 T40 G41 G42 R43 N44 N45 N46 G47 R48 I49 T50 T51 R52 G55 G56 H58 K59 Q60 H61 Y62 R63 I74 Y83 P85 N86 R87 K95 A97 D98 G99 E100 R101 K147 I148 G149 K150 Q153 M154 A155 R156 A157 A158 Y171 L176 R177 S178 E180 R182 T198 N200 N201 S204 L205 G206 K207 A208 G209 S211 R212 W213 R214 R217 P218 S219 V220 R221 G222 V223 A224 M225 N226 P227 V228 D229 H230 H232 G234 G235 E236 G237 R238 N239 K240 G241 R242 H243 P244 S246 P247 W248 Q250 K251 S252 K253 G254 L255 K256 T257 R258 H259 K261 R262 T263	K6 P7 T8 S9 P10 G11 R12 R13 F14 K17 R27 E34 S37 K38 T39 G40 G41 R42 N43 N44 N45 G46 R47 I48 T49 T50 R51 G54 G55 H57 K58 Q59 H60 Y61 R62 I73 Y82 P84 N85 R86 K94 A96 D97 G98 E99 R100 K146 I147 G148 K149 Q152 M153 A154 R155 A156 A157 Y170 L175 R176 S177 E179 R181 T197 N199 N200 S203 L204 G205 K206 A207 G208 S210 R211 W212 R213 R216 P217 S218 V219 R220 G221 V222 A223 M224 N225 P226 V227 D228 H229 H231 G233 G234 E235 G236 R237 N238 K239 G240 R241 H242 P243 S245 P246 W247 Q249 K250 S251 K252 G253 L254 K255 T256 R257 H258 K260 R261 T262

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum	8rd8
PubMed	38355796
UniProt	A0A0M3V8Q0

[Back to BioLiP]