Structure of PDB 8jiv Chain Cl

Receptor sequence

>8jivCl (length=50) Species: 4565 (Triticum aestivum) [Search protein sequence]

PSHKTFRIKQKLAKKQRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cl	P2 S3 H4 K5 K10 L13 Q17 I35 R36 Y37 N38 A39 K40 R41 R42 H43 W44 R45 K48 L49	P1 S2 H3 K4 K9 L12 Q16 I34 R35 Y36 N37 A38 K39 R40 R41 H42 W43 R44 K47 L48
BS02	rna	Cl	F7 R8 Q11 K12 K15 Q19 R21 I23 P24 W26 I27 M29 R30 T31 I35	F6 R7 Q10 K11 K14 Q18 R20 I22 P23 W25 I26 M28 R29 T30 I34

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links