Structure of PDB 4v7e Chain Cl

Receptor sequence

>4v7eCl (length=51) Species: 4565 (Triticum aestivum) [Search protein sequence]

MPSHKTFRIKQKLAKKQRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLG
F

3D structure

PDB

4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.

Chain

Resolution

5.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cl	M1 P2 H4 K5 L13 Q17 P22 T34 R36 Y37 N38 A39 K40 R42 W44 R45 T47 K48	M1 P2 H4 K5 L13 Q17 P22 T34 R36 Y37 N38 A39 K40 R42 W44 R45 T47 K48
BS02	rna	Cl	H4 K5 T6 F7 R8 Q11 K12 K15 R18 R21 P22 I23 P24 W26 I27 R30	H4 K5 T6 F7 R8 Q11 K12 K15 R18 R21 P22 I23 P24 W26 I27 R30

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links