Structure of PDB 4v7e Chain Ck

Receptor sequence

>4v7eCk (length=69) Species: 4565 (Triticum aestivum)

MPKQIHEIKDFLLTARRKDARSVRIKRTKDAVKFKVRCSKYLYTLCVFDA
DKANKLKQSLPPGLTVQEV

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: Ck
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ck	M1 P2 K3 Q4 R17 R24 K26 R27 K29 D30 A31 K33 K35 R37 C38 S39 K40 Y41 L42 Y43 V69	M1 P2 K3 Q4 R17 R24 K26 R27 K29 D30 A31 K33 K35 R37 C38 S39 K40 Y41 L42 Y43 V69

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon May 5 09:43:08 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1472         else:

=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1474     

   1475     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7e', asym_id = 'Ck', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7e', asym_id='Ck', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')

    840 

    841     if go:

=>  842         display_go(go,uniprot,pdbid,asym_id)

    843     return pubmed,uniprot

    844 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v7e', asym_id = 'Ck'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v7e', asym_id='Ck')

    481         '''.replace("$namespace_link",namespace_link

    482           ).replace("$namespace",namespace

=>  483           ).replace("$uniprot",u

    484         ))

    485         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>