Structure of PDB 6xu6 Chain Cj

Receptor sequence

>6xu6Cj (length=87) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

TKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSR
KAKGRKAQGTGRMRYLKNLRRRFRNGLREGGAAKKKT

3D structure

PDB

6xu6 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cj	T17 R20 R21 C22 G23 Y27 L29 Q59 G60 G62 R63 M64 R65 Y66 L67 R71 R72 F74 N76 E80 G81 G82 A84 K85 K86 K87	T16 R19 R20 C21 G22 Y26 L28 Q58 G59 G61 R62 M63 R64 Y65 L66 R70 R71 F73 N75 E79 G80 G81 A83 K84 K85 K86
BS02	rna	Cj	T2 K3 G4 T5 T6 F8 G9 K10 R11 H12 N13 T15 H16 S25 H28 Q30 K31 S35 Q36 K43 R45 F47 N48 W49 S50 R51 K52 R56 Q59 R71 R75	T1 K2 G3 T4 T5 F7 G8 K9 R10 H11 N12 T14 H15 S24 H27 Q29 K30 S34 Q35 K42 R44 F46 N47 W48 S49 R50 K51 R55 Q58 R70 R74

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6xu6, PDBe:6xu6, PDBj:6xu6
PDBsum	6xu6
PubMed	34283226
UniProt	Q9W1U6\|RL372_DROME Large ribosomal subunit protein L37-2 (Gene Name=RpL37-2)