Structure of PDB 8jiv Chain Ci

Receptor sequence
>8jivCi (length=99) Species: 4565 (Triticum aestivum) [Search protein sequence]
SQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRNLIREVAGF
APYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRS
3D structure
PDB8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
ChainCi
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ci K7 H18 V20 K22 R28 P29 S30 R32 K33 G34 G36 T37 K38 R39 Y56 K70 R71 K74 R78 K79 G81 H83 R85 K87 K88 K4 H15 V17 K19 R25 P26 S27 R29 K30 G31 G33 T34 K35 R36 Y53 K67 R68 K71 R75 K76 G78 H80 R82 K84 K85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum8jiv
PubMed38458197
UniProtA0A1D5S805

[Back to BioLiP]