Structure of PDB 8jiv Chain Ch

Receptor sequence
>8jivCh (length=116) Species: 4565 (Triticum aestivum) [Search protein sequence]
VKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHDIRKSI
ARVLTVINAKQRAQLRLFYKKYAPLDLRAKQTRAIRRRLSPDEKSRVLEK
TKKRTVHFPQRKFAIK
3D structure
PDB8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
ChainCh
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ch R85 R94 S97 P98 D99 L105 K107 K110 R111 V113 H114 K119 R78 R87 S90 P91 D92 L98 K100 K103 R104 V106 H107 K112
BS02 rna Ch K7 W12 K37 N46 R52 A56 R57 L59 T60 N63 R67 R71 K87 T89 R90 R93 K2 W7 K32 N41 R47 A51 R52 L54 T55 N58 R62 R66 K80 T82 R83 R86
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum8jiv
PubMed38458197
UniProtQ8L805|RL35_WHEAT Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]