Structure of PDB 4v7e Chain Ch

Receptor sequence

>4v7eCh (length=124) Species: 4565 (Triticum aestivum)

MSSGKVKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHD
IRKSIARVLTVINAKQRAQLRLFYKNKKYAPLDLRAKQTRAIRRRLSPDE
KSRVLEKTKKRTVHFPQRKFAIKA

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: Ch
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ch	K75 N76 K77 K78 A80 R90 I92 R94 R95 K107 T108 K109 R111 F120 K123 A124	K75 N76 K77 K78 A80 R90 I92 R94 R95 K107 T108 K109 R111 F120 K123 A124
BS02	rna	Ch	S2 S3 K7 A8 G9 W12 K37 K44 L45 I48 R52 K53 I55 A56 R57 L59 T60 R67 L84 R85 T89 R90 I92 R93	S2 S3 K7 A8 G9 W12 K37 K44 L45 I48 R52 K53 I55 A56 R57 L59 T60 R67 L84 R85 T89 R90 I92 R93

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
• PDBsum: 4v7e
• PubMed: 24499919
• UniProt: Q8L805|RL35_WHEAT Large ribosomal subunit protein uL29 (Gene Name=RPL35)