Structure of PDB 8pv5 Chain Cg

Receptor sequence

>8pv5Cg (length=188) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

LPVTVEKPTPYTFDLGLLLANDPNPVNVPKTTDTQVLEQHLASVARDGAQ
VLINQLLTTTTITATKDGVLLTLPPPTTPLPREKPVPQPKPETKWQAFAR
RRGIKPKTREQRRNLQYNPTTGQWERKWGYKGANKRGETDPIIEVSAAKE
AMRPEGTSVRGDKRREIRARVKKNQKQMLRNQRIAAEK

3D structure

PDB

8pv5 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.86 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cg	K104 W105 F108 R112 I114 K115 K117 T118 R119 R122 N124 R136 W138 G139 Y140 N144 K145 T167 R175 I177 R180 N184 Q187 M188 R190 N191 R193 E197	K94 W95 F98 R102 I104 K105 K107 T108 R109 R112 N114 R126 W128 G129 Y130 N134 K135 T157 R165 I167 R170 N174 Q177 M178 R180 N181 R183 E187

Gene Ontology

	Biological Process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv5, PDBe:8pv5, PDBj:8pv5
PDBsum	8pv5
PubMed	37921038
UniProt	G0SCH6

[Back to BioLiP]