Structure of PDB 6xu6 Chain Cg

Receptor sequence

>6xu6Cg (length=103) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

VQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKL
KGITPSRPSERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIV
KAL

3D structure

PDB

6xu6 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cg	V2 R4 L5 T6 R8 R9 R10 L11 S12 Y13 N14 T15 K19 R20 R21 R24 T25 P26 G27 R29 K37 N38 P42 R43 K48 K52 G53 P56 R58 P59 S60 R62 P63 S66 K67 R68 K70 T71 S73 R74 T75 Y76 G78 V79 H82 R88 R91 A92 I95 E96 Q98	V1 R3 L4 T5 R7 R8 R9 L10 S11 Y12 N13 T14 K18 R19 R20 R23 T24 P25 G26 R28 K36 N37 P41 R42 K47 K51 G52 P55 R57 P58 S59 R61 P62 S65 K66 R67 K69 T70 S72 R73 T74 Y75 G77 V78 H81 R87 R90 A91 I94 E95 Q97

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links