Structure of PDB 8pv4 Chain Cf

Receptor sequence

>8pv4Cf (length=285) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

PRNARSKRALEKRAPKIVENPKTCLFLRGTTCSQITQDAMNDLYAMRQVH
AKRFHKKNAIHPFEDATSLCFFSEKNDCSLMVFGSSNKKRPHTLTFVRMF
DYKVLDMLEFYLDPDTYRSISQFKTSKIPIGMRPMMVFAGTAFESPVPNA
FTMAKSMLIDFFRGEPSDKIDVEGLRFVVVVTADEPQKPILRLRVYGIRT
KRSGTRLPRVEVEEHGPRMDFRLGRMREPDPAMLKEAMKKAKTPQEERTK
KNISMDLLGDKIGRIHMGKTDLSKLQTRKMKGLKR

3D structure

PDB

8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cf	N9 R11 R14 F60 H61 K62 N64 S74 F77 F78 K81 N82 P278 Q279 E280 E281 R282 K285 N286 M289 G293 K295 R298 H300 M301 L309 Q310 T311 R312 K313 L317	N3 R5 R8 F54 H55 K56 N58 S68 F71 F72 K75 N76 P244 Q245 E246 E247 R248 K251 N252 M255 G259 K261 R264 H266 M267 L275 Q276 T277 R278 K279 L283
BS02	rna	Cf	Q40 Q43 R59 H67 E70 N93 K94 K95 R96 R259	Q34 Q37 R53 H61 E64 N87 K88 K89 R90 R225

Gene Ontology

	Molecular Function
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470	maturation of LSU-rRNA
GO:0006364	rRNA processing

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv4, PDBe:8pv4, PDBj:8pv4
PDBsum	8pv4
PubMed	37921038
UniProt	G0SF80

[Back to BioLiP]