Structure of PDB 7e81 Chain Cf |
>7e81Cf (length=150) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
DAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEH YSPNGDASKATLRSRQLNISEQVPRSTQRNETSNYEVDRTIRHTKMNVGD IERLSVAVVVNYKLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFS |
|
PDB | 7e81 Structural basis of assembly and torque transmission of the bacterial flagellar motor. |
Chain | Cf |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
Cf |
R294 T363 N365 |
R63 T82 N84 |
|
|
|
|