Structure of PDB 4ujd Chain Ce

Receptor sequence
>4ujdCe (length=51) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
LARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGP
N
3D structure
PDB4ujd Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires
ChainCe
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Ce R8 G10 K11 V12 R13 T16 V19 K21 Q22 K25 K27 K28 T29 G30 R31 A32 R35 Q37 N39 R41 V43 N44 P47 K53 G54 P55 N56 R3 G5 K6 V7 R8 T11 V14 K16 Q17 K20 K22 K23 T24 G25 R26 A27 R30 Q32 N34 R36 V38 N39 P42 K48 G49 P50 N51
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Mar 7 09:23:20 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujd', asym_id = 'Ce', title = 'Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujd', asym_id='Ce', title='Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4ujd', asym_id = 'Ce'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4ujd', asym_id='Ce')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>