Structure of PDB 4ujc Chain Ce

Receptor sequence

>4ujcCe (length=51) Species: 9986 (Oryctolagus cuniculus)

LARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGP
N

3D structure

• PDB: 4ujc Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.
• Chain: Ce
• Resolution: 9.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ce	R8 G10 K11 V12 R13 T16 V19 K21 Q22 K25 K27 K28 T29 G30 R31 A32 R35 Q37 N39 R41 V43 N44 P47 K53 G54 P55 N56	R3 G5 K6 V7 R8 T11 V14 K16 Q17 K20 K22 K23 T24 G25 R26 A27 R30 Q32 N34 R36 V38 N39 P42 K48 G49 P50 N51

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Mar 7 09:21:21 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujc', asym_id = 'Ce', title = 'Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujc', asym_id='Ce', title='Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4ujc', asym_id = 'Ce'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4ujc', asym_id='Ce')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>