Structure of PDB 9cai Chain Cb

Receptor sequence
>9caiCb (length=52) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
AKSKNHTNHNQNKKAHRNGITKPKKHIFLSMKGVDAKFIKNLRFSRKNNK
RQ
3D structure
PDB9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.
ChainCb
Resolution2.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Cb A2 K3 S4 K5 N6 H7 T8 N9 H10 N11 Q12 N13 K15 H17 R18 N19 K23 M32 D36 K38 F39 N42 R44 F45 S46 R47 N49 N50 R52 A1 K2 S3 K4 N5 H6 T7 N8 H9 N10 Q11 N12 K14 H16 R17 N18 K22 M31 D35 K37 F38 N41 R43 F44 S45 R46 N48 N49 R51
External links