Structure of PDB 8jiv Chain Cb

Receptor sequence

>8jivCb (length=49) Species: 4565 (Triticum aestivum) [Search protein sequence]

AKSKNHTAHNQSYKAHRNGIKKPKRQRQASTKGMDPKFLRNLRYSRKHN

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cb	A2 K3 S4 K5 N6 H7 T8 A9 H10 N11 Q12 S13 Y14 K15 H17 R18 N19 R26 Q27 R28 Q29 S31 T32 D36 P37 K38 R41 N42 L43 R44 Y45 S46 R47 H49 N50	A1 K2 S3 K4 N5 H6 T7 A8 H9 N10 Q11 S12 Y13 K14 H16 R17 N18 R25 Q26 R27 Q28 S30 T31 D35 P36 K37 R40 N41 L42 R43 Y44 S45 R46 H48 N49

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links