Structure of PDB 6xu8 Chain Cb

Receptor sequence

>6xu8Cb (length=75) Species: 7227 (Drosophila melanogaster)

AKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNL
SREESVKRYNERIASQKGKPKPVTL

3D structure

• PDB: 6xu8 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
• Chain: Cb
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Cb	K3 S4 K5 N6 H7 T8 N9 H10 N11 Q12 K14 K15 R18 N19 R23 R26 K27 R28 H29 S31 T32 V37 K38 I41 N42 Q43 R44 Y45 A46 R47 G49 R53 E54 V57 Y60 N61 I64 K70 V74 L76	K2 S3 K4 N5 H6 T7 N8 H9 N10 Q11 K13 K14 R17 N18 R22 R25 K26 R27 H28 S30 T31 V36 K37 I40 N41 Q42 R43 Y44 A45 R46 G48 R52 E53 V56 Y59 N60 I63 K69 V73 L75

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xu8, PDBe:6xu8, PDBj:6xu8
• PDBsum: 6xu8
• PubMed: 34283226
• UniProt: Q24154|RL29_DROME Large ribosomal subunit protein eL29 (Gene Name=RpL29)