Structure of PDB 6rxu Chain Ca

Receptor sequence

>6rxuCa (length=225) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

RLSKGKKGLKKKVQDPFTRKDWYNIKAPAPFAVRDVGKTLVNRTTGLKNA
NDALKGRIFEVCLADLQKDEDHAFRKIKLRVDEVQGKNCLTNFHGLDFTT
DKLRSLVRKWQTLIEANVTVTTTDHYLLRLFAIAFTKRRPNQIKKTTYAQ
SSQIRAIRRKMVEIIQREAASCTLHQLVSKLIPEVIGREIEKATQGIYPL
QNVHIRKVKLLKQPKFDLGALMALH

3D structure

PDB

6rxu Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ca	K11 L16 K18 K55 V114 R115 K116 W117 L120 R136 F138 R146 N148 Q149 K151 Y155 Q157 S158 S159 Q160 R165 Q202 G203 I204 Y205 P206 K214 K216	K4 L9 K11 K48 V107 R108 K109 W110 L113 R129 F131 R139 N141 Q142 K144 Y148 Q150 S151 S152 Q153 R158 Q195 G196 I197 Y198 P199 K207 K209

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6rxu, PDBe:6rxu, PDBj:6rxu
PDBsum	6rxu
PubMed	31378463
UniProt	G0S7T8

[Back to BioLiP]