Structure of PDB 4v5s Chain CZ

Receptor sequence

>4v5sCZ (length=385) Species: 300852 (Thermus thermophilus HB8)

AKGEFVRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVINTAHVEY
ETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPV
IRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYIPTPVRDVDKP
FLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRRTVVTGV
EMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASV
YVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTF
TVELIKPVALEEGLRFAIREGGRTVGAGVVTKILE

3D structure

• PDB: 4v5s How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
• Chain: CZ
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CZ	T232 G233 R234 G235 T268 R291	T212 G213 R214 G215 T248 R271
BS02	rna	CZ	N64 D87 Y88 K90 F229 T230 I231 T232 R234 V237 T239 G269 V270 E271 H273 R274 N285 G287 R295 R330 H331 T332 G337 Y338 R339 Q341 D348 T350 E390 G391 G392	N44 D67 Y68 K70 F209 T210 I211 T212 R214 V217 T219 G249 V250 E251 H253 R254 N265 G267 R275 R310 H311 T312 G317 Y318 R319 Q321 D328 T330 E370 G371 G372
BS03	rna	CZ	H19 V20 H85 P114	H19 V20 H65 P94
BS04	GDP	CZ	D21 H22 G23 K24 T25 T26 N136 K137 S174 L176	D21 H22 G23 K24 T25 T26 N116 K117 S154 L156
BS05	KIR	CZ	I93 L121 R124 Q125 Y161 E162 E327 R345 R385 F386 A387 A397	I73 L101 R104 Q105 Y141 E142 E307 R325 R365 F366 A367 A377

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4v5s, PDBe:4v5s, PDBj:4v5s
• PDBsum: 4v5s
• PubMed: 21378964
• UniProt: Q5SHN6|EFTU1_THET8 Elongation factor Tu-A (Gene Name=tufA)