Structure of PDB 4bts Chain CZ |
>4btsCZ (length=97) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] |
MNSGRANQRSKPMTGLINDKKEKIDAYLPRKCDWSNKLIFSNDQSSVQIA IAEVGENGQATGSKTNVVLCGSVRSKGEAHIALENILRERGLYPIQE |
|
PDB | 4bts The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A. |
Chain | CZ |
Resolution | 3.703 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
CZ |
G71 S75 K76 |
G71 S75 K76 |
|
|
|
Biological Process |
GO:0000447 |
endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0000461 |
endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0006412 |
translation |
|
|