Structure of PDB 6xu7 Chain CY

Receptor sequence

>6xu7CY (length=131) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

KQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRR
DDEVQVIRGHFKGNQVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIHP
SKVLIVKLKLDKDRKAILERRGKGRLAALGK

3D structure

PDB

6xu7 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.

Chain

Resolution

4.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CY	R11 R12 R15 F19 H24 R27 R51 Q72 Y74 R75 K76 K113 D114 R115	R10 R11 R14 F18 H23 R26 R50 Q71 Y73 R74 K75 K112 D113 R114
BS02	rna	CY	K2 Q3 V7 S8 S9 R11 K13 N14 R15 R17 H18 L29 P33 K36 V44 R45 S46 R59 H61 K77 R87 N89 A90 N91 H100 S102 K103 R121 R122 G125 R126	K1 Q2 V6 S7 S8 R10 K12 N13 R14 R16 H17 L28 P32 K35 V43 R44 S45 R58 H60 K76 R86 N88 A89 N90 H99 S101 K102 R120 R121 G124 R125

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

External links