Structure of PDB 6c5l Chain CY

Receptor sequence

>6c5lCY (length=351) Species: 274 (Thermus thermophilus)

LAQRLEGLRGYLDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAARL
RRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYHQT
LLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVD
LTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSF
AGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGQGVNTTDSAVRVVHLP
TGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRGEVRPI
EWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKAGR
R

3D structure

• PDB: 6c5l Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
• Chain: CY
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CY	E78 L79 G123 A124 G126 R142 R146 R188 S198 R201 I305 E306 W307 Q310 K318 N319 Y320 K322	E73 L74 G118 A119 G121 R137 R141 R183 S193 R196 I300 E301 W302 Q305 K313 N314 Y315 K317
BS02	rna	CY	P160 G238 G239 R266	P155 G233 G234 R261
BS03	rna	CY	G125 G126 T127 S193 R200 R201 H202 T203	G120 G121 T122 S188 R195 R196 H197 T198
BS04	rna	CY	W39 R46 S49 A53 R56 Q121 M232 R233 S235 G236 P237 G238 G239 X240 G241 V242 N243 T244 D246 R250 T261 R266 Q268 R303	W34 R41 S44 A48 R51 Q116 M227 R228 S230 G231 P232 G233 G234 X235 G236 V237 N238 T239 D241 R245 T256 R261 Q263 R298

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6c5l, PDBe:6c5l, PDBj:6c5l
• PDBsum: 6c5l
• PubMed: 29403017
• UniProt: Q5SM01|RF2_THET8 Peptide chain release factor RF2 (Gene Name=prfB)