Structure of PDB 4v9q Chain CY

Receptor sequence
>4v9qCY (length=62) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKI
RDLKRQIARLLT
3D structure
PDB4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
ChainCY
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CY M1 K2 L3 R7 Q46 N47 H48 I50 R51 K54 R55 A58 R59 L61 M1 K2 L3 R7 Q46 N47 H48 I50 R51 K54 R55 A58 R59 L61
BS02 MG CY A58 T62 A58 T62
BS03 MG CY Q46 N47 Q46 N47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
PDBsum4v9q
PubMed23824292
UniProtQ72I12|RL29_THET2 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]