Structure of PDB 4v8x Chain CY

Receptor sequence
>4v8xCY (length=84) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKH
NLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY
3D structure
PDB4v8x Yoeb-Ribosome Structure: A Canonical Rnase that Requires the Ribosome for its Specific Activity.
ChainCY
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CY R22 K26 K42 G43 K44 E46 P47 K49 S53 I60 E62 E63 R22 K26 K42 G43 K44 E46 P47 K49 S53 I60 E62 E63
BS02 rna CY E46 H50 N51 R59 E62 E63 R65 H83 Y84 E46 H50 N51 R59 E62 E63 R65 H83 Y84
BS03 rna CY F39 W56 D72 F39 W56 D72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0016892 RNA endonuclease activity, producing 3'-phosphomonoesters
GO:0042803 protein homodimerization activity
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006401 RNA catabolic process
GO:0006402 mRNA catabolic process
GO:0009408 response to heat
GO:0040008 regulation of growth
GO:0044010 single-species biofilm formation
GO:0045947 negative regulation of translational initiation
GO:0098795 global gene silencing by mRNA cleavage
Cellular Component
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8x, PDBe:4v8x, PDBj:4v8x
PDBsum4v8x
PubMed23945936
UniProtP69348|YOEB_ECOLI Toxin YoeB (Gene Name=yoeB)

[Back to BioLiP]