Structure of PDB 8jiv Chain CX

Receptor sequence

>8jivCX (length=116) Species: 4565 (Triticum aestivum) [Search protein sequence]

RTSVTFHRPKTLSKARDPKYPRISTPGRNKLDQYQILKYPLTTESAMKKI
EDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKKKAYVKL
TPDYDALDVANKIGII

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CX	V40 T41 F42 H43 R44 P45 K46 S49 K50 R52 D53 K55 Y56 R58 T79 K85 N89 D101 K102 K119 N121 T122 I124 P126 K130 K131 Y133	V4 T5 F6 H7 R8 P9 K10 S13 K14 R16 D17 K19 Y20 R22 T43 K49 N53 D65 K66 K83 N85 T86 I88 P90 K94 K95 Y97
BS02	rna	CX	R37 P45 T47 L48 R52 R64 N65 K66 K99 K103	R1 P9 T11 L12 R16 R28 N29 K30 K63 K67

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links