Structure of PDB 4v8h Chain CX

Receptor sequence

>4v8hCX (length=95) Species: 83333 (Escherichia coli K-12)

MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTS
DATLHVNGGEIHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH

3D structure

• PDB: 4v8h How Hibernation Factors RMF, HPF, and YfiA Turn Off Protein Synthesis.
• Chain: CX
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CX	Y30 H62 A63 S64 K80 Q84 K89 K91 Q94 H95	Y30 H62 A63 S64 K80 Q84 K89 K91 Q94 H95

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0043022 ribosome binding
• GO:0043024 ribosomal small subunit binding

Biological Process

• GO:0006417 regulation of translation
• GO:0017148 negative regulation of translation
• GO:0022611 dormancy process
• GO:0044238 primary metabolic process
• GO:0045900 negative regulation of translational elongation

Cellular Component

• GO:0005829 cytosol
• GO:0022627 cytosolic small ribosomal subunit

External links

• PDB: RCSB:4v8h, PDBe:4v8h, PDBj:4v8h
• PDBsum: 4v8h
• PubMed: 22605777
• UniProt: P0AFX0|HPF_ECOLI Ribosome hibernation promoting factor (Gene Name=hpf)