Structure of PDB 4v7e Chain CX

Receptor sequence

>4v7eCX (length=122) Species: 4565 (Triticum aestivum)

RKSKKIRTSVTFHRPKTLKKARDPKYPRVSAPGRNKLDQYQILKYPLTTE
SAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKK
KAYVKLTPDYDALDVANKIGII

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: CX
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CX	R31 S33 K34 T41 P45 K46 T47 L48 K49 K50 A51 D53 P54 K55 Y56 R58 T79 E80 S81 K85 N89 D101 K102 K119 N121 L123 I124 R125 K130 K131 Y133 K135	R1 S3 K4 T11 P15 K16 T17 L18 K19 K20 A21 D23 P24 K25 Y26 R28 T49 E50 S51 K55 N59 D71 K72 K89 N91 L93 I94 R95 K100 K101 Y103 K105
BS02	rna	CX	K32 K34 R37 R52 P54 R64 D68 Q69 Y70 D97 L98 K99 K103 D127 K129 K130	K2 K4 R7 R22 P24 R34 D38 Q39 Y40 D67 L68 K69 K73 D97 K99 K100

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon May 5 09:55:34 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1472         else:

=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1474     

   1475     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7e', asym_id = 'CX', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7e', asym_id='CX', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')

    840 

    841     if go:

=>  842         display_go(go,uniprot,pdbid,asym_id)

    843     return pubmed,uniprot

    844 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v7e', asym_id = 'CX'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v7e', asym_id='CX')

    481         '''.replace("$namespace_link",namespace_link

    482           ).replace("$namespace",namespace

=>  483           ).replace("$uniprot",u

    484         ))

    485         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>