Structure of PDB 4v67 Chain CX

Receptor sequence

>4v67CX (length=362) Species: 274 (Thermus thermophilus)

NASRNAWKASGGIFDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAA
RLRRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYH
QTLLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEV
VDLTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHT
SFAGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGQGVNTTDSAVRVVH
LPTGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRGEVR
PIEWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKA
GRRQGTEEVEAE

3D structure

• PDB: 4v67 Crystal structure of a translation termination complex formed with release factor RF2.
• Chain: CX
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CX	P93 A137 G139 R155 R201 S211 R213 R214 W320 Q323 K331 K335	P77 A121 G123 R139 R185 S195 R197 R198 W304 Q307 K315 K319
BS02	rna	CX	G138 G139 T140 E141 V203 S206 R213 R214 H215 T216	G122 G123 T124 E125 V187 S190 R197 R198 H199 T200
BS03	rna	CX	W52 R59 S62 G136 A137 M245 R246 S248 G249 P250 G251 G252 Q253 G254 V255 N256 T257 T258 D259 R263 V273 T274 T277 R279 Q281 I282 R295 R316	W36 R43 S46 G120 A121 M229 R230 S232 G233 P234 G235 G236 Q237 G238 V239 N240 T241 T242 D243 R247 V257 T258 T261 R263 Q265 I266 R279 R300

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4v67, PDBe:4v67, PDBj:4v67
• PDBsum: 4v67
• PubMed: 19064930
• UniProt: Q5SM01|RF2_THET8 Peptide chain release factor RF2 (Gene Name=prfB)