Structure of PDB 4wqy Chain CW

Receptor sequence

>4wqyCW (length=112) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEKHG

3D structure

PDB

4wqy Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CW	K4 I6 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 E52 S53 A56 N57 N60 N61 H62 D77 E78 P80 K83 R84 L86 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 R99	K4 I6 R8 Y9 R11 S13 R15 K16 R18 R25 N40 K41 R42 Y45 K49 E52 S53 A56 N57 N60 N61 H62 D77 E78 P80 K83 R84 L86 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 K98 R99
BS02	MG	CW	R88 G91	R88 G91

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4wqy, PDBe:4wqy, PDBj:4wqy
PDBsum	4wqy
PubMed	25594181
UniProt	Q5SHP3\|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)