Structure of PDB 4v8b Chain CW

Receptor sequence

>4v8bCW (length=99) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 4v8b A new understanding of the decoding principle on the ribosome.
• Chain: CW
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CW	L10 K14 R15 H16 R17 S19 R22 R23 N26 A28 K29 S31 A32 T35 K39 E51 R57 E60 S61 D64 K65 S70 K74 A78 R79 K81 S82 R83 M85 R89 G103 L104 S105	L3 K7 R8 H9 R10 S12 R15 R16 N19 A21 K22 S24 A25 T28 K32 E44 R50 E53 S54 D57 K58 S63 K67 A71 R72 K74 S75 R76 M78 R82 G96 L97 S98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8b, PDBe:4v8b, PDBj:4v8b
• PDBsum: 4v8b
• PubMed: 22437501
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)